Protein Info for Rv2387 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 310 to 335 (26 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF05982: Sbt_1" amino acids 16 to 402 (387 residues), 330.2 bits, see alignment E=6.9e-103

Best Hits

KEGG orthology group: K07086, (no description) (inferred from 100% identity to mbt:JTY_2395)

Predicted SEED Role

"putative sodium-dependent bicarbonate transporter" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>Rv2387 Conserved protein (Mycobacterium tuberculosis H37Rv)
MLHEFWVNFTHNLFKPLLLFFYFGFLIPIFKVRFEFPYVLYQGLTLYLLLAIGWHGGEEL
AKIKPSNVGAIVGFMVVGFALNFVIGTLAYFLLSKLTAMRRVDRATVAGYYGSDSAGTFA
TCVAVLTSVGMAFDAYMPVMLAVMEIPGCLVALYLVARLRHRGMNEAGYMADEPGYTTAA
MIGAGPGTPARPAHSDSLTAQAERGIEEELELSLEKREHPNWDEDGVKDSGTNASIFSRE
LLQEVFLNPGLVLLFGGIVIGLISGLQGQKVLHDDDNFFVAAFQGVLCLFLLEMGMTASR
KLKDLASAGSGFVFFGLLAPNLFATLGIIVAHGYAYVTNNDFAPGTYVLFAVLCGAASYI
AVPAVQRLAIPEASPTLPLAASLGLTFSYNVTIGIPLYIEIARIVGQWFPATGASIG