Protein Info for Rv2382c in Mycobacterium tuberculosis H37Rv

Annotation: Polyketide synthetase MbtC (polyketide synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00109: ketoacyl-synt" amino acids 5 to 254 (250 residues), 273.2 bits, see alignment E=3.5e-85 PF00108: Thiolase_N" amino acids 166 to 210 (45 residues), 32.4 bits, see alignment 1e-11 PF02801: Ketoacyl-synt_C" amino acids 262 to 378 (117 residues), 122.3 bits, see alignment E=1.7e-39

Best Hits

KEGG orthology group: K04790, mycobactin polyketide synthetase MbtC (inferred from 100% identity to mtf:TBFG_12407)

MetaCyc: 100% identical to polyketide synthetase (Mycobacterium tuberculosis H37Rv)
2.3.1.-

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>Rv2382c Polyketide synthetase MbtC (polyketide synthase) (Mycobacterium tuberculosis H37Rv)
MSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRELFDGSRRNGF
KPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLRVAWRTLENSGINPDDLAGHD
VGCYVGASALEYGPALTEFSHHSGHLITGTSLGVISGRIAYTLDLAGPALTVDTSCSSAL
AAFHTAVQAIRAGDCDLALAGGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWA
EGAAMFLLQRRSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGHAQAAAGGLGL
VKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTPWRAVDGWRTAAVSAFGMSGT
NSHVIVSMPDTVSAPERGPECGEV