Protein Info for Rv2378c in Mycobacterium tuberculosis H37Rv

Annotation: Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (lysine N6-hydroxylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13434: Lys_Orn_oxgnase" amino acids 88 to 284 (197 residues), 39.4 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 100% identical to MBTG_MYCBO: L-lysine N6-monooxygenase MbtG (mbtG) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K04793, mycobactin lysine-N-oxygenase (inferred from 100% identity to mbo:Mb2399c)

MetaCyc: 100% identical to lysine-N-oxygenase (Mycobacterium tuberculosis H37Rv)
L-lysine 6-monooxygenase (NADPH). [EC: 1.14.13.59]

Predicted SEED Role

"L-lysine 6-monooxygenase MbtG (EC 1.14.13.59) [mycobactin] siderophore" (EC 1.14.13.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>Rv2378c Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (lysine N6-hydroxylase) (Mycobacterium tuberculosis H37Rv)
MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLG
TSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATASFAEWIDRGRPAPTHRRWSQ
YLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPR
VLSIAQFWDRAAGHDRINAERVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGE
GFFENSLFSDPTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTA
DRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCLGLLSDRVLGAGIFTPTKHND
TRRSGEHQSFR