Protein Info for Rv2364c in Mycobacterium tuberculosis H37Rv

Annotation: Probable GTP-binding protein Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00436: GTP-binding protein Era" amino acids 7 to 283 (277 residues), 242.2 bits, see alignment E=6.3e-76 TIGR00231: small GTP-binding protein domain" amino acids 8 to 169 (162 residues), 67.9 bits, see alignment E=9e-23 PF10662: PduV-EutP" amino acids 9 to 170 (162 residues), 22.1 bits, see alignment E=3.5e-08 PF01926: MMR_HSR1" amino acids 9 to 126 (118 residues), 76.9 bits, see alignment E=4.1e-25 PF02421: FeoB_N" amino acids 9 to 65 (57 residues), 31.4 bits, see alignment E=4e-11 PF00009: GTP_EFTU" amino acids 50 to 175 (126 residues), 27 bits, see alignment E=9.6e-10 PF07650: KH_2" amino acids 210 to 289 (80 residues), 71.6 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 100% identical to ERA_MYCBP: GTPase Era (era) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to mtc:MT2433)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv2364c Probable GTP-binding protein Era (Mycobacterium tuberculosis H37Rv)
MTEFHSGFVCLVGRPNTGKSTLTNALVGAKVAITSTRPQTTRHAIRGIVHSDDFQIILVD
TPGLHRPRTLLGKRLNDLVRETYAAVDVIGLCIPADEAIGPGDRWIVEQLRSTGPANTTL
VVIVTKIDKVPKEKVVAQLVAVSELVTNAAEIVPVSAMTGDRVDLLIDVLAAALPAGPAY
YPDGELTDEPEEVLMAELIREAALQGVRDELPHSLAVVIDEVSPREGRDDLIDVHAALYV
ERDSQKGIVIGKGGARLREVGTAARSQIENLLGTKVYLDLRVKVAKNWQRDPKQLGRLGF