Protein Info for Rv2344c in Mycobacterium tuberculosis H37Rv

Annotation: Probable deoxyguanosine triphosphate triphosphohydrolase Dgt (dGTPase) (dGTP triphosphohydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR01353: putative dGTPase" amino acids 35 to 411 (377 residues), 242.2 bits, see alignment E=6.8e-76 PF01966: HD" amino acids 72 to 220 (149 residues), 53.7 bits, see alignment E=2.5e-18 PF13286: HD_assoc" amino acids 330 to 417 (88 residues), 57.9 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 100% identical to DGTL1_MYCBO: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (dgt) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to mtc:MT2409)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>Rv2344c Probable deoxyguanosine triphosphate triphosphohydrolase Dgt (dGTPase) (dGTP triphosphohydrolase) (Mycobacterium tuberculosis H37Rv)
VSASEHDPYDDFDRQRRVAEAPKTAGLPGTEGQYRSDFARDRARVLHSAALRRLADKTQV
VGPREGDTPRTRLTHSLEVAQIGRGMAIGLGCDLDLVELAGLAHDIGHPPYGHNGERALD
EVAASHGGFEGNAQNFRILTSLEPKVVDAQGLSAGLNLTRASLDAVTKYPWMRGDGLGSQ
RRKFGFYDDDRESAVWVRQGAPPERACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVL
AAEEDAAALARLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSE
LVGRFASAAIATTRAAAGPGPLVRFRADLQVPDLVRAEVAVLKILALQFIMSDPRHLETQ
ARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADDAARLRVVVDQIASYTEGRLERIDA
DQLGVSRNALD