Protein Info for Rv2335 in Mycobacterium tuberculosis H37Rv

Annotation: Probable serine acetyltransferase CysE (sat)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01172: serine O-acetyltransferase
  • amino acids 6 to 166 (161 residues), 253.9 bits, E=3.3e-80
• PF00132: Hexapep
  • amino acids 117 to 150 (34 residues), 36.7 bits, 1.2e-13

Best Hits

Swiss-Prot: 100% identical to CYSE_MYCTU: Serine acetyltransferase (cysE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 100% identity to mtc:MT2398)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• L-cysteine biosynthesis I (2/2 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
• D-cycloserine biosynthesis (1/6 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Protein Sequence (229 amino acids)

>Rv2335 Probable serine acetyltransferase CysE (sat) (Mycobacterium tuberculosis H37Rv)
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFT
RILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTV
GDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFD
WRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI