Protein Info for Rv2333c in Mycobacterium tuberculosis H37Rv

Annotation: Integral membrane drug efflux protein Stp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 476 to 497 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 7 to 412 (406 residues), 285 bits, see alignment E=5.4e-89 PF07690: MFS_1" amino acids 14 to 403 (390 residues), 191.4 bits, see alignment E=1.1e-60

Best Hits

Swiss-Prot: 100% identical to STP_MYCTU: Multidrug resistance protein Stp (stp) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT2395)

Predicted SEED Role

"Drug resistance transporter, EmrB/QacA subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>Rv2333c Integral membrane drug efflux protein Stp (Mycobacterium tuberculosis H37Rv)
MNRTQLLTLIATGLGLFMIFLDALIVNVALPDIQRSFAVGEDGLQWVVASYSLGMAVFIM
SAATLADLDGRRRWYLIGVSLFTLGSIACGLAPSIAVLTTARGAQGLGAAAVSVTSLALV
SAAFPEAKEKARAIGIWTAIASIGTTTGPTLGGLLVDQWGWRSIFYVNLPMGALVLFLTL
CYVEESCNERARRFDLSGQLLFIVAVGALVYAVIEGPQIGWTSVQTIVMLWTAAVGCALF
VWLERRSSNPMMDLTLFRDTSYALAIATICTVFFAVYGMLLLTTQFLQNVRGYTPSVTGL
MILPFSAAVAIVSPLVGHLVGRIGARVPILAGLCMLMLGLLMLIFSEHRSSALVLVGLGL
CGSGVALCLTPITTVAMTAVPAERAGMASGIMSAQRAIGSTIGFAVLGSVLAAWLSATLE
PHLERAVPDPVQRHVLAEIIIDSANPRAHVGGIVPRRHIEHRDPVAIAEEDFIEGIRVAL
LVATATLAVVFLAGWRWFPRDVHTAGSDLSERLPTAMTVECAVSHMPGATWCRLWPA