Protein Info for Rv2330c in Mycobacterium tuberculosis H37Rv

Annotation: Probable lipoprotein LppP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF14041: Lipoprotein_21" amino acids 79 to 162 (84 residues), 91.4 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 99% identical to LPPP_MYCTO: Putative lipoprotein LppP (lppP) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_2345)

Predicted SEED Role

"PROBABLE LIPOPROTEIN LPPP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>Rv2330c Probable lipoprotein LppP (Mycobacterium tuberculosis H37Rv)
VRRQRSAVPILALLALLALLALIVGLGASGCAWKPPTTRPSPPNTCKDSDGPTADTVRQA
IAAVPIVVPGSKWVEITRGHTRNCRLHWVQIIPTIASQSTPQQLLFFDRNIPLGSPTRNP
KPYITVLPAGDDTVTVQYQWQIGSDQECCPTGIGTVRFHIGSDGKLEALGSIPHQ