Protein Info for Rv2329c in Mycobacterium tuberculosis H37Rv

Annotation: Probable nitrite extrusion protein 1 NarK1 (nitrite facilitator 1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 53 to 70 (18 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details amino acids 416 to 439 (24 residues), see Phobius details amino acids 453 to 472 (20 residues), see Phobius details PF07690: MFS_1" amino acids 62 to 433 (372 residues), 64 bits, see alignment E=6e-22

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to mtc:MT2391)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>Rv2329c Probable nitrite extrusion protein 1 NarK1 (nitrite facilitator 1) (Mycobacterium tuberculosis H37Rv)
MEQHTLLQREESPRSPAAPSLRRLGGSRHITHWDPEDLGAWEAGNKGIARRNLLWSVVTV
HLGYSVWTLWPVLELLMPQDVYGFSTSDKFLLGTIATLFGAFLRMPYALASAIFGGRNWA
TFSAIVLLIPAIGTTVLLTHPGLPLWPYLVCAALTGLGGGNFASSMSNANAFYPHRLKGS
ALGIAGGVGNLGVPAIQLVGLLAIATVGERKPYLVCALYVVLVAIAVIGVSLFMNNVEQH
RVQVNRLRPIVSAVLSTRDTWLLSLLYLGTFGSFIGFSFVFGQVLQTNFLACGQSPARAT
LHAVELAFVGPLLAAVARIYGGRLADRVGGSRLTLIVFVAMTLAAGLLISASTLEGRHVG
QHRGATMVGYFVCFVALFVLSGLGNGSVYKMIPTIFEACSRSLDLSEAERRDWSRIISGV
VIGFVAAFGALGGVGINMALRESYLSTGSGTDAFWIFMMCYAAAAVLTWKVYDRRTVTDM
GMLQAALVRQPASTPAELIGPRTQSDRFSGCSISA