Protein Info for Rv2328 in Mycobacterium tuberculosis H37Rv

Annotation: PE family protein PE23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 228 to 248 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details PF00934: PE" amino acids 4 to 94 (91 residues), 106.8 bits, see alignment E=2.8e-35

Best Hits

Swiss-Prot: 100% identical to PE23_MYCBO: Uncharacterized PE family protein PE23 (PE23) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01651)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>Rv2328 PE family protein PE23 (Mycobacterium tuberculosis H37Rv)
MQFLSVIPEQVESAAQDLAGIRSALSASYAAAAGPTTAVVSAAEDEVSTAIASIFGAYGR
QCQVLSAQASAFHDEFVNLLKTGATAYRNTEFANAQSNVLNAVNAPARSLLGHPSAAESV
QNSAPTLGGGHSTVTAGLAAQAGRAVATVEQQAAAAVAPLPSAGAGLAQVVNGVVTAGQG
SAAKLATALQSAAPWLAKSGGEFIVAGQSALTGVALLQPAVVGVVQAGGTFLTAGTSAAT
GLGLLTLAGVEFSQGVGNLALASGTAATGLGLLGSAGVQLFSPAFLLAVPTALGGVGSLA
IAVVQLVQGVQHLSLVVPNVVAGIAALQTAGAQFAQGVNHTMLAAQLGAPGIAVLQTAGG
HFAQGIGHLTTAGNAAVTVLIS