Protein Info for Rv2326c in Mycobacterium tuberculosis H37Rv

Annotation: Possible transmembrane ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 transmembrane" amino acids 40 to 67 (28 residues), see Phobius details amino acids 80 to 107 (28 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 268 to 401 (134 residues), 76.5 bits, see alignment E=6.6e-25 amino acids 497 to 635 (139 residues), 77.4 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 100% identical to Y2326_MYCTU: Uncharacterized ABC transporter ATP-binding protein Rv2326c (Rv2326c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 100% identity to mtc:MT2388)

Predicted SEED Role

"Candidate substrate-specific domain of ECF transporters in Mycobacteria / Duplicated ATPase component of energizing module of predicted ECF transporter in Mycobacteria" in subsystem ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (697 amino acids)

>Rv2326c Possible transmembrane ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MCCAVCGPEPGRIGEVTPLGPCPAQHRGGPLRPSELAQASVMAALCAVTAIISVVVPFAA
GLALLGTVPTGLLAYRYRLRVLAAATVAAGMIAFLIAGLGGFMGVVHSAYIGGLTGIVKR
RGRGTPTVVVSSLIGGFVFGAAMVGMLAAMVRLRHLIFKVMTANVDGIAATLARMHMQGA
AADVKRYFAEGLQYWPWVLLGYFNIGIMIVSLIGWWALSRLLERMRGIPDVHKLDPPPGD
DVDALIGPVPVRLDKVRFRYPRAGQDALREVSLDVRAGEHLAIIGANGSGKTTLMLILAG
RAPTSGTVDRPGTVGLGKLGGTAVVLQHPESQVLGTRVADDVVWGLPLGTTADVGRLLSE
VGLEALAERDTGSLSGGELQRLALAAALAREPAMLIADEVTTMVDQQGRDALLAVLSGLT
QRHRTALVHITHYDNEADSADRTLSLSDSPDNTDMVHTAAMPAPVIGVDQPQHAPALELV
GVGHEYASGTPWAKTALRDINFVVEQGDGVLIHGGNGSGKSTLAWIMAGLTIPTTGACLL
DGRPTHEQVGAVALSFQAARLQLMRSRVDLEVASAAGFSASEQDRVAAALTVVGLDPALG
ARRIDQLSGGQMRRVVLAGLLARAPRALILDEPLAGLDAASQRGLLRLLEDLRRARGLTV
VVVSHDFAGMEELCPRTLHLRDGVLESAAASEAGGMS