Protein Info for Rv2319c in Mycobacterium tuberculosis H37Rv

Annotation: Universal stress protein family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00582: Usp" amino acids 3 to 140 (138 residues), 72.9 bits, see alignment E=2e-24 amino acids 158 to 291 (134 residues), 43 bits, see alignment E=3.4e-15

Best Hits

Swiss-Prot: 100% identical to Y2346_MYCBO: Universal stress protein Mb2346c (BQ2027_MB2346C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_2340c)

Predicted SEED Role

"Universal stress protein family" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>Rv2319c Universal stress protein family protein (Mycobacterium tuberculosis H37Rv)
VTIVVGYLAGKVGPSALHLAVRVARMHKTSLTVATIVRRHWPTPSLARVDAEYELWSEQL
AAASAREAQRYLRRLADGIEVSYHHRAHRSVSAGLLDVVEELEAEVLVLGSFPSGRRARV
LIGSTADRLLHSSPVPVAITPRRYRCYTDRLTRLSCGYSATSGSVDVVRRCGHLASRYGV
PMRVITFAVRGRTMYPPEVGLHAEASVLEAWAAQARELLEKLRINGVVSEDVVLQVVTGN
GWAQALDAADWQDGEILALGTSPFGDVARVFLGSWSGKIIRYSPVPVLVLPG