Protein Info for Rv2299c in Mycobacterium tuberculosis H37Rv

Annotation: Probable chaperone protein HtpG (heat shock protein) (HSP90 family protein) (high temperature protein G)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 PF13589: HATPase_c_3" amino acids 33 to 157 (125 residues), 40.7 bits, see alignment E=3.5e-14 PF02518: HATPase_c" amino acids 33 to 183 (151 residues), 27.4 bits, see alignment E=5.9e-10 PF00183: HSP90" amino acids 235 to 645 (411 residues), 451 bits, see alignment E=1e-138

Best Hits

Swiss-Prot: 100% identical to HTPG_MYCTO: Chaperone protein HtpG (htpG) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to mtc:MT2356)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (647 amino acids)

>Rv2299c Probable chaperone protein HtpG (heat shock protein) (HSP90 family protein) (high temperature protein G) (Mycobacterium tuberculosis H37Rv)
MNAHVEQLEFQAEARQLLDLMVHSVYSNKDAFLRELISNASDALDKLRIEALRNKDLEVD
TSDLHIEIDADKAARTLTVRDNGIGMAREEVVDLIGTLAKSGTAELRAQLREAKNAAASE
ELIGQFGIGFYSSFMVADKVQLLTRKAGESAATRWESSGEGTYTIESVEDAPQGTSVTLH
LKPEDAEDDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPASQEEGGEGGEETVTIE
TETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFEYQALLFIPSH
APFDLFDRDAHVGIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLNVSREILQQDR
QIKAIRRRLTKKVLSTIKDVQSSRPEDYRTFWTQFGRVLKEGLLSDIDNRETLLGISSFV
STYSEEEPTTLAEYVERMKDGQQQIFYATGETRQQLLKSPHLEAFKAKGYEVLLLTDPVD
EVWVGMVPEFDGKPLQSVAKGEVDLSSEEDTSEAEREERQKEFADLLTWLQETLSDHVKE
VRLSTRLTESPACLITDAFGMTPALARIYRASGQEVPVGKRILELNPSHPLVTGLRQAHQ
DRADDAEKSLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL