Protein Info for Rv2289 in Mycobacterium tuberculosis H37Rv

Annotation: Probable CDP-diacylglycerol pyrophosphatase Cdh (CDP-diacylglycerol diphosphatase) (CDP-diacylglycerol phosphatidylhydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02611: CDH" amino acids 41 to 257 (217 residues), 250.1 bits, see alignment E=1e-78

Best Hits

Swiss-Prot: 100% identical to CDH_MYCTU: Probable CDP-diacylglycerol pyrophosphatase (cdh) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01521, CDP-diacylglycerol pyrophosphatase [EC: 3.6.1.26] (inferred from 100% identity to mbo:Mb2311)

Predicted SEED Role

"CDP-diacylglycerol pyrophosphatase (EC 3.6.1.26)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.6.1.26)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>Rv2289 Probable CDP-diacylglycerol pyrophosphatase Cdh (CDP-diacylglycerol diphosphatase) (CDP-diacylglycerol phosphatidylhydrolase) (Mycobacterium tuberculosis H37Rv)
VPKSRRAVSLSVLIGAVIAALAGALIAVTVPARPNRPEADREALWKIVHDRCEFGYRRTG
AYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDPALRESAGRNYLYDAWAARFL
VTARLNNSLPESDVVLTINPKNARTQDQLHIHISCSSPTTSAALRNVDTSEYVGWKQLPI
DLGGRRFQGLAVDTKAFESRNLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGT
EDQPVAAETLQDHDCSITKS