Protein Info for Rv2285 in Mycobacterium tuberculosis H37Rv

Annotation: Possible triacylglycerol synthase (diacylglycerol acyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF03007: WS_DGAT_cat" amino acids 4 to 256 (253 residues), 286.7 bits, see alignment E=2.3e-89 TIGR02946: acyltransferase, WS/DGAT/MGAT" amino acids 4 to 443 (440 residues), 473.8 bits, see alignment E=3.1e-146 PF06974: WS_DGAT_C" amino acids 295 to 439 (145 residues), 96.9 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 100% identical to Y2306_MYCBO: Putative diacyglycerol O-acyltransferase Mb2306 (BQ2027_MB2306) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv2285)

Predicted SEED Role

"Diacyglycerol O-acyltransferase (EC 2.3.1.20)" (EC 2.3.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.20

Use Curated BLAST to search for 2.3.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>Rv2285 Possible triacylglycerol synthase (diacylglycerol acyltransferase) (Mycobacterium tuberculosis H37Rv)
VKLLSPLDQMFARMEAPRTPMHIGAFAVFDLPKGAPRRFIRDLYEAISQLAFLPFPFDSV
IAGGASMAYWRQVQPDPSYHVRLSALPYPGTGRDLGALVERLHSTPLDMAKPLWELHLIE
GLTGRQFAMYFKAHHCAVDGLGGVNLIKSWLTTDPEAPPGSGKPEPFGDDYDLASVLAAA
TTKRAVEGVSAVSELAGRLSSMVLGANSSVRAALTTPRTPFNTRVNRHRRLAVQVLKLPR
LKAVAHATDCTVNDVILASVGGACRRYLQELGDLPTNTLTASVPVGFERDADTVNAASGF
VAPLGTSIEDPVARLTTISASTTRGKAELLAMSPNALQHYSVFGLLPIAVGQKTGALGVI
PPLFNFTVSNVVLSKDPLYLSGAKLDVIVPMSFLCDGYGLNVTLVGYTDKVVLGFLGCRD
TLPHLQRLAQYTGAAFEELETAALP