Protein Info for Rv2284 in Mycobacterium tuberculosis H37Rv

Annotation: Probable esterase LipM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details PF00135: COesterase" amino acids 166 to 275 (110 residues), 44.5 bits, see alignment E=2.2e-15 PF20434: BD-FAE" amino acids 177 to 372 (196 residues), 160.1 bits, see alignment E=1.2e-50 PF07859: Abhydrolase_3" amino acids 186 to 392 (207 residues), 72.1 bits, see alignment E=1.2e-23 PF00326: Peptidase_S9" amino acids 208 to 392 (185 residues), 50.1 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to mtu:Rv2284)

Predicted SEED Role

"LipO"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>Rv2284 Probable esterase LipM (Mycobacterium tuberculosis H37Rv)
MGAPRLIHVIRQIGALVVAAVTAAATINAYRPLARNGFASLWSWFIGLVVTEFPLPTLAS
QLGGLVLTAQRLTRPVRAVSWLVAAFSALGLLNLSRAGRQADAQLTAALDSGLGPDRRTA
SAGLWRRPAGGGTAKTPGPLRMLRIYRDYAHDGDISYGEYGRANHLDIWRRPDLDLTGTA
PVLFQIPGGAWTTGNKRGQAHPLMSHLAELGWICVAINYRHSPRNTWPDHIIDVKRALAW
VKAHISEYGGDPDFIAITGGSAGGHLSSLAALTPNDPRFQPGFEEADTRVQAAVPFYGVY
DFTRLQDAMHPMMLPLLERMVVKQPRTANMQSYLDASPVTHISADAPPFFVLHGRNDSLV
PVQQARGFVDQLRQVSKQPVVYAELPFTQHAFDLLGSARAAHTAIAVEQFLAEVYATQHA
GSEPGPAVAIP