Protein Info for Rv2280 in Mycobacterium tuberculosis H37Rv

Annotation: Probable dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF01565: FAD_binding_4" amino acids 40 to 178 (139 residues), 132.9 bits, see alignment E=6.9e-43 PF02913: FAD-oxidase_C" amino acids 217 to 454 (238 residues), 209.6 bits, see alignment E=6.3e-66

Best Hits

Swiss-Prot: 100% identical to Y2280_MYCTO: Uncharacterized FAD-linked oxidoreductase MT2338 (MT2338) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01704)

Predicted SEED Role

"Probable dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>Rv2280 Probable dehydrogenase (Mycobacterium tuberculosis H37Rv)
MSEMTARFSEIVGNANLLTGDAIPEDYAHDEELTGPPQKPAYAAKPATPEEVAQLLKAAS
ENGVPVTARGSGCGLSGAARPVEGGLLISFDRMNKVLEVDTANQVAVVQPGVALTDLDAA
TADTGLRYTVYPGELSSSVGGNVGTNAGGMRAVKYGVARHNVLGLQAVLPTGEIIRTGGR
MAKVSTGYDLTQLIIGSEGTLALVTEVIVKLHPRLDHNASVLAPFADFDQVMAAVPKILA
SGLAPDILEYIDNTSMAALISTQNLELGIPDQIRDSCEAYLLVALENRIADRLFEDIQTV
GEMLMELGAVDAYVLEGGSARKLIEAREKAFWAAKALGADDIIDTVVPRASMPKFLSTAR
GLAAAADGAAVGCGHAGDGNVHMAIACKDPEKKKKLMTDIFALAMELGGAISGEHGVGRA
KTGYFLELEDPVKISLMRRIKQSFDPAGILNPGVVFGDT