Protein Info for Rv2247 in Mycobacterium tuberculosis H37Rv

Annotation: Acetyl/propionyl-CoA carboxylase (beta subunit) AccD6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01039: Carboxyl_trans
  • amino acids 39 to 460 (422 residues), 427 bits, E=1.5e-131
• PF03255: ACCA
  • amino acids 286 to 459 (174 residues), 32.3 bits, E=9.2e-12
• PF06833: MdcE
  • amino acids 316 to 467 (152 residues), 32.7 bits, E=9.4e-12

Best Hits

Swiss-Prot: 100% identical to PCC6_MYCBO: Probable propionyl-CoA carboxylase beta chain 6 (accD6) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2258)

MetaCyc: 100% identical to acetyl/propionyl-CoA carboxylase beta chain (Mycobacterium tuberculosis H37Rv)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Propionyl-CoA carboxylase beta chain (EC 6.4.1.3)" in subsystem Serine-glyoxylate cycle (EC 6.4.1.3)

MetaCyc Pathways

• mycolate biosynthesis (165/205 steps found)
• superpathway of fatty acid biosynthesis II (plant) (34/43 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (39/53 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (11/16 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• methylaspartate cycle (11/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• candicidin biosynthesis (1/6 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of mycolate biosynthesis (166/239 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.3

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.3

Protein Sequence (473 amino acids)

>Rv2247 Acetyl/propionyl-CoA carboxylase (beta subunit) AccD6 (Mycobacterium tuberculosis H37Rv)
MTIMAPEAVGESLDPRDPLLRLSNFFDDGSVELLHERDRSGVLAAAGTVNGVRTIAFCTD
GTVMGGAMGVEGCTHIVNAYDTAIEDQSPIVGIWHSGGARLAEGVRALHAVGQVFEAMIR
ASGYIPQISVVVGFAAGGAAYGPALTDVVVMAPESRVFVTGPDVVRSVTGEDVDMASLGG
PETHHKKSGVCHIVADDELDAYDRGRRLVGLFCQQGHFDRSKAEAGDTDIHALLPESSRR
AYDVRPIVTAILDADTPFDEFQANWAPSMVVGLGRLSGRTVGVLANNPLRLGGCLNSESA
EKAARFVRLCDAFGIPLVVVVDVPGYLPGVDQEWGGVVRRGAKLLHAFGECTVPRVTLVT
RKTYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGILHKKKLAAAPEHEREALHDQ
LAAEHERIAGGVDSALDIGVVDEKIDPAHTRSKLTEALAQAPARRGRHKNIPL