Protein Info for Rv2236c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cobalamin biosynthesis transmembrane protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 13 to 308 (296 residues), 174.5 bits, see alignment E=1.6e-55 PF03186: CobD_Cbib" amino acids 14 to 292 (279 residues), 302.1 bits, see alignment E=1.9e-94

Best Hits

Swiss-Prot: 100% identical to COBD_MYCTU: Cobalamin biosynthesis protein CobD (cobD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 99% identity to mbb:BCG_2253c)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>Rv2236c Probable cobalamin biosynthesis transmembrane protein CobD (Mycobacterium tuberculosis H37Rv)
VFASTWQTRAVGVLIGCLLDVVFGDPKRGHPVALFGRAAAKLEQITYRDGRVAGAVHVGL
LVGAVGLLGAALQRLPGRSWPVAATATATWAALGGTSLARTGRQISDLLERDDVEAARRL
LPSLCGRDPAQLGGPGLTRAALESVAENTADAQVVPLLWAASSGVPAVLGYRAINTLDSM
IGYRSPRYLRFGWAAARLDDWANYVGARATAVLVVICAPVVGGSPRGAVRAWRRDAARHP
SPNAGVVEAAFAGALDVRLGGPTRYHHELQIRPTLGDGRSPKVADLRRAVVLSRVVQAGA
AVLAVMLVYRRRP