Protein Info for Rv2231c in Mycobacterium tuberculosis H37Rv

Annotation: Possible aminotransferase CobC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to Y2231_MYCTU: Uncharacterized aminotransferase Rv2231c (Rv2231c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2250)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
aminopropanol phosphate biosynthesis I (1/2 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (25/36 steps found)
superpathway of L-threonine metabolism (12/18 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>Rv2231c Possible aminotransferase CobC (Mycobacterium tuberculosis H37Rv)
VLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGVLDFAVNVRHDRPPEWLVRQL
AALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGAAEGFALLHNLSPVRAAIVVP
AFTEPAIALSAAGITAHHVVLKPPFVLDTAHVPDDADLVVVGNPTNPTSVLHLREQLLEL
RRPGRILVVDEAFADWVPGEPQSLADDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLA
RLTVQRAHWPLGTLQLTAIAACCAPRAVAAAAADAVRLTALRAEMVAGLRSVGAEVVDGA
APFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVLVAAIAEWAKR
GGRR