Protein Info for Rv2230c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00486: dinuclear metal center protein, YbgI/SA1388 family" amino acids 3 to 354 (352 residues), 132.4 bits, see alignment E=1.2e-42 PF01784: DUF34_NIF3" amino acids 4 to 364 (361 residues), 203.1 bits, see alignment E=3e-64

Best Hits

Swiss-Prot: 100% identical to GCH1L_MYCBO: GTP cyclohydrolase 1 type 2 homolog (BQ2027_MB2255C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv2230c)

Predicted SEED Role

"UPF0135 protein Bsu YqfO @ Bsu YqfO NIF3/CutA domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>Rv2230c Conserved protein (Mycobacterium tuberculosis H37Rv)
MSVRLADVIDVLDQAYPPRLAQSWDSVGLVCGDPDDVVDSVTVAVDATPAVVDQVPQAGL
LLVHHPLLLRGVDTVAANTPKGVLVHRLIRTGRSLFTAHTNADSASPGVSDALAHAVGLT
VDAVLDPVPGAADLDKWVIYVPRENSEAVRAAVFEAGAGHIGDYSHCSWSVAGTGQFLAH
DGASPAIGSVGTVERVAEDRVEVVAPARARAEVLAAMRAAHPYEEPAFDIFALVPPPVGS
GLGRIGRLPKPEPLRTFVARLEAALPPTATGVRAAGDPDLLVSRVAVCGGAGDSLLATVA
AADVQAYVTADLRHHPADEHCRASQVALIDVAHWASEFPWCGQAAEVLRSHFGASLPVRV
CTICTDPWNLDHETGRDQA