Protein Info for Rv2228c in Mycobacterium tuberculosis H37Rv

Annotation: Multifunctional protein. Has RNASE H,alpha-ribazole phosphatase, and acid phosphatase activities.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00075: RNase_H" amino acids 3 to 129 (127 residues), 35.7 bits, see alignment E=1.4e-12 PF13456: RVT_3" amino acids 7 to 129 (123 residues), 82.8 bits, see alignment E=3e-27 PF00300: His_Phos_1" amino acids 167 to 359 (193 residues), 183.2 bits, see alignment E=6.8e-58

Best Hits

Swiss-Prot: 100% identical to RNHPH_MYCTU: Bifunctional protein Rv2228c (Rv2228c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2240)

Predicted SEED Role

"FIG006762: Phosphoglycerate mutase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>Rv2228c Multifunctional protein. Has RNASE H,alpha-ribazole phosphatase, and acid phosphatase activities. (Mycobacterium tuberculosis H37Rv)
VKVVIEADGGSRGNPGPAGYGAVVWTADHSTVLAESKQAIGRATNNVAEYRGLIAGLDDA
VKLGATEAAVLMDSKLVVEQMSGRWKVKHPDLLKLYVQAQALASQFRRINYEWVPRARNT
YADRLANDAMDAAAQSAAADADPAKIVATESPTSPGWTGARGTPTRLLLLRHGQTELSEQ
RRYSGRGNPGLNEVGWRQVGAAAGYLARRGGIAAVVSSPLQRAYDTAVTAARALALDVVV
DDDLVETDFGAWEGLTFAEAAERDPELHRRWLQDTSITPPGGESFDDVLRRVRRGRDRII
VGYEGATVLVVSHVTPIKMLLRLALDAGSGVLYRLHLDLASLSIAEFYADGASSVRLVNQ
TGYL