Protein Info for Rv2225 in Mycobacterium tuberculosis H37Rv

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PANB_MYCBP: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 100% identity to mtf:TBFG_12254)

MetaCyc: 46% identical to ketopantoate hydroxymethyltransferase (Arabidopsis thaliana col)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
phosphopantothenate biosynthesis III (archaea) (2/4 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>Rv2225 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB (Mycobacterium tuberculosis H37Rv)
MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLV
GDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATR
FLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQ
TIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFS
GAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHSF