Protein Info for Rv2218 in Mycobacterium tuberculosis H37Rv

Annotation: Probable lipoate biosynthesis protein A LipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 17 to 304 (288 residues), 332.7 bits, E=1.1e-103
• PF16881: LIAS_N
  • amino acids 18 to 60 (43 residues), 36.3 bits, 6.4e-13
• PF04055: Radical_SAM
  • amino acids 78 to 233 (156 residues), 68.7 bits, E=7e-23

Best Hits

Swiss-Prot: 100% identical to LIPA_MYCBP: Lipoyl synthase (lipA) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to mtc:MT2275)

MetaCyc: 46% identical to lipoyl synthase (lipoic acid synthetase) (Bacillus subtilis subtilis 168)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (311 amino acids)

>Rv2218 Probable lipoate biosynthesis protein A LipA (Mycobacterium tuberculosis H37Rv)
MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGC
PNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATV
TGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHN
VETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAG
CDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYE
QARNSRALASR