Protein Info for Rv2209 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 49 to 49 (1 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to Y2209_MYCTU: Uncharacterized protein Rv2209 (Rv2209) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01772)

Predicted SEED Role

"Probable conserved integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>Rv2209 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MPASRLVRQVSAPRNLFGRLVAQGGFYTAGLQLGSGAVVLPVICAHQGLTWAAGLLYPAF
CIGAILGNSLSPLILQRAGQLRHLLMAAISATAAALVVCNAAVPWTGVGVAAVFLATTGA
GGVVTGVSSVAYTDMISSMLPAVRRGELLLTQGAAGSVLATGVTLVIVPMLAHGNEMARY
HDLLWLGAAGLVCSGIAALFVGPMRSVSVTTATRMPLREIYWMGFAIARSQPWFRRYMTT
YLLFVPISLGTTFFSLRAAQSNGSLHVLVILSSIGLVVGSMLWRQINRLFGVRGLLLGSA
LLNAAAALLCMVAESCGQWVHAWAYGTAFLLATVAAQTVVAASISWISVLAPERYRATLI
CVGSTLAAVEATVLGVALGGIAQKHATIWPVVVVLTLAVIAAVASLRAPTRIGVTADTSP
QAATLQAYRPATPNPIHSDERSTPPDHLSVRRGQLRHVWDSRRPAPPLNRPSCRRAARRP
APGKPAAALPQPRHPAVGVREGAPLDAGQRIA