Protein Info for Rv2193 in Mycobacterium tuberculosis H37Rv

Annotation: Probable cytochrome C oxidase (subunit III) CtaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to COX3_MYCTO: Probable cytochrome c oxidase subunit 3 (ctaE) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to mra:MRA_2209)

MetaCyc: 34% identical to cytochrome aa3-600 quinol oxidase (subunit III) (Bacillus subtilis subtilis 168)
RXN-12164 [EC: 7.1.1.5]

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (2/2 steps found)
succinate to cytochrome aa₃ oxidase electron transfer (2/2 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
NADH to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
arsenite to oxygen electron transfer (1/2 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>Rv2193 Probable cytochrome C oxidase (subunit III) CtaE (Mycobacterium tuberculosis H37Rv)
VTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAFYFSARAQAGGNWPP
PPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYE
YRNLMSHGTSIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIV
VSYYWHFVDIVWIALFTVIYFIR