Protein Info for Rv2188c in Mycobacterium tuberculosis H37Rv

Annotation: Mannosyltransferase PimB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 16 to 177 (162 residues), 58.1 bits, E=3e-19
• PF20706: GT4-conflict
  • amino acids 177 to 374 (198 residues), 37.4 bits, E=3.8e-13
• PF00534: Glycos_transf_1
  • amino acids 186 to 360 (175 residues), 150.6 bits, E=7.9e-48
• PF13692: Glyco_trans_1_4
  • amino acids 197 to 345 (149 residues), 112 bits, E=6.9e-36
• PF13524: Glyco_trans_1_2
  • amino acids 292 to 375 (84 residues), 40.7 bits, E=5.6e-14

Best Hits

Swiss-Prot: 100% identical to PIMB_MYCTO: GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase (pimB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K13668, phosphatidylinositol alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to mbb:BCG_2204c)

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.52

Protein Sequence (385 amino acids)

>Rv2188c Mannosyltransferase PimB (Mycobacterium tuberculosis H37Rv)
VSRVLLVTNDFPPRRGGIQSYLGEFVGRLVGSRAHAMTVYAPQWKGADAFDDAARAAGYR
VVRHPSTVMLPGPTVDVRMRRLIAEHDIETVWFGAAAPLALLAPRARLAGASRVLASTHG
HEVGWSMLPVARSVLRRIGDGTDVVTFVSSYTRSRFASAFGPAASLEYLPPGVDTDRFRP
DPAARAELRKRYRLGERPTVVCLSRLVPRKGQDTLVTALPSIRRRVDGAALVIVGGGPYL
ETLRKLAHDCGVADHVTFTGGVATDELPAHHALADVFAMPCRTRGAGMDVEGLGIVFLEA
SAAGVPVIAGNSGGAPETVQHNKTGLVVDGRSVDRVADAVAELLIDRDRAVAMGAAGREW
VTAQWRWDTLAAKLADFLRGDDAAR