Protein Info for Rv2181 in Mycobacterium tuberculosis H37Rv

Annotation: Alpha(1->2)mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 74 to 82 (9 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 168 to 168 (1 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 330 to 346 (17 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 391 to 408 (18 residues), see Phobius details PF09594: GT87" amino acids 80 to 324 (245 residues), 206.3 bits, see alignment E=3e-65

Best Hits

Swiss-Prot: 100% identical to PIMG_MYCTU: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase (Rv2181) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K13671, alpha-1,2-mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to mbt:JTY_2190)

Predicted SEED Role

"FIG01121868: possible membrane protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>Rv2181 Alpha(1->2)mannosyltransferase (Mycobacterium tuberculosis H37Rv)
MSAWRAPEVGSRLGRRVLWCLLWLLAGVALGYVAWRLFGHTPYRIDIDIYQMGARAWLDG
RPLYGGGVLFHTPIGLNLPFTYPPLAAVLFSPFAWLQMPAASVAITVLTLVLLIASTAIV
LTGLDAWPTSRLVPAPARLRRLWLAVLIVAPATIWLEPISSNFAFGQINVVLMTLVIVDC
FPRRTPWPRGLMLGLGIALKLTPAVFLLYFLLRRDGRAALTALASFAVATLLGFVLAWRD
SWEYWTHTLHHTDRIGAAALNTDQNIAGALARLTIGDDERFALWVAGSLLVLAATIWAMR
RVLRAGEPTLAVICVALFGLVVSPVSWSHHWVWMLPAVLVIGLLGWRRRNVALAMLSLAG
VVLMRWTPIDLLPQHRETTAVWWRQLAGMSYVWWALAVIVVAGLTVTARMTPQRSLTRGL
TPAPTAS