Protein Info for Rv2180c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_2189)

Predicted SEED Role

"Possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>Rv2180c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
LEVFHWLQHDIVDRGRLPLLCCLVAFVLTFLVTRSFVRFIHRRAADGRPARWWQPRNVHI
GSVHIHHVAFGVVLVMISGLTLVTLSVDGREPEFTIAASIFGVGAALVLDEYALILHLSD
VYWEEDGRTSVDAVFAAVAVAGLLIMGLHPLIFFLPVRQGANWVVLQTTLIAGLVLTLPL
AVVVLLKGKVWTGLLGMFVVVLLVVGAVRLSRPHAPWARWRYTRHPEKMRRALQRERTWR
RPVVRIKLWLQYVIAGTPRMPDERAVDAQLDQDVRPAPPPERTAPILISGSVWSD