Protein Info for Rv2140c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein TB18.6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF01161: PBP" amino acids 39 to 173 (135 residues), 131.5 bits, see alignment E=1.3e-42 TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 41 to 171 (131 residues), 127.9 bits, see alignment E=1.3e-41

Best Hits

Swiss-Prot: 100% identical to Y2164_MYCBO: UPF0098 protein Mb2164c (BQ2027_MB2164C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06910, (no description) (inferred from 100% identity to mra:MRA_2154)

Predicted SEED Role

"Phospholipid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>Rv2140c Conserved protein TB18.6 (Mycobacterium tuberculosis H37Rv)
MTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQLRWSGFPSETR
SFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMRRYVG
AAPPPGHGVHRYYVAVHAVKVEKLDLPEDASPAYLGFNLFQHAIARAVIFGTYEQR