Protein Info for Rv2136c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00753: undecaprenyl-diphosphatase UppP
  • amino acids 6 to 261 (256 residues), 346.6 bits, E=4.9e-108
• PF02673: BacA
  • amino acids 7 to 262 (256 residues), 263.8 bits, E=1e-82

Best Hits

Swiss-Prot: 100% identical to UPPP_MYCTA: Undecaprenyl-diphosphatase (uppP) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to mbo:Mb2160c)

MetaCyc: 100% identical to decaprenyl diphosphate phosphatase (Mycobacterium tuberculosis H37Rv)
3.6.1.-

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (33/33 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (5/5 steps found)
• di-trans,poly-cis-undecaprenyl phosphate biosynthesis (2/2 steps found)
• polyisoprenoid biosynthesis (E. coli) (4/5 steps found)

KEGG Metabolic Maps

• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Protein Sequence (276 amino acids)

>Rv2136c Possible conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFA
RDIVRILSAWLHGLVVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVT
ALVVFSGVIALAEYVGRQSRHIERLTWRDAVVVGIAQTLALVPGVSRSGSTISAGLFLGL
DRELAARFGFLLAIPAVFASGLFSLPDAFHPVTEGMSATGPQLLVATLIAFVLGLTAVAW
LLRFLVRHNMYWFVGYRVLVGTGMLVLLATGTVAAT