Protein Info for Rv2127 in Mycobacterium tuberculosis H37Rv

Annotation: L-asparagine permease AnsP1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 415 to 432 (18 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 444 (419 residues), 374.5 bits, see alignment E=7.5e-116 PF13520: AA_permease_2" amino acids 26 to 449 (424 residues), 122.9 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 100% identical to ANSP1_MYCTO: L-asparagine permease 1 (ansP1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K11738, L-asparagine permease (inferred from 100% identity to mra:MRA_2141)

Predicted SEED Role

"L-asparagine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>Rv2127 L-asparagine permease AnsP1 (Mycobacterium tuberculosis H37Rv)
LSAASQRVGAFGEEAGYHKGLKPRQLQMIGIGGAIGTGLFLGAGGRLAKAGPGLFLVYGV
CGVFVFLILRALGELVLHRPSSGSFVSYAREFFGEKAAYAVGWMYFLHWAMTSIVDTTAI
ATYLQRWTIFTVVPQWILALIALTVVLSMNLISVEWFGELEFWAALIKVLALMAFLVVGT
VFLAGRYPVDGHSTGLSLWNNHGGLFPTSWLPLLIVTSGVVFAYSAVELVGTAAGETAEP
EKIMPRAINSVVARIAIFYVGSVALLALLLPYTAYKAGESPFVTFFSKIGFHGAGDLMNI
VVLTAALSSLNAGLYSTGRVMHSIAMSGSAPRFTARMSKSGVPYGGIVLTAVITLFGVAL
NAFKPGEAFEIVLNMSALGIIAGWATIVLCQLRLHKLANAGIMQRPRFRMPFSPYSGYLT
LLFLLVVLVTMASDKPIGTWTVATLIIVIPALTAGWYLVRKRVMAVARERLGHTGPFPAV
ANPPVRSRD