Protein Info for Rv2122c in Mycobacterium tuberculosis H37Rv

Annotation: Phosphoribosyl-AMP pyrophosphatase HisE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 11 to 93 (83 residues), 76.7 bits, see alignment E=6.5e-26 PF01503: PRA-PH" amino acids 12 to 93 (82 residues), 40.2 bits, see alignment E=3.8e-14 PF03819: MazG" amino acids 39 to 92 (54 residues), 24.7 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 99% identical to HIS2_MYCBO: Phosphoribosyl-ATP pyrophosphatase (hisE) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to mtf:TBFG_12154)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (93 amino acids)

>Rv2122c Phosphoribosyl-AMP pyrophosphatase HisE (Mycobacterium tuberculosis H37Rv)
VQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHES
NDALAEEISQLLYWTQVLMISRGLSLDDVYRKL