Protein Info for Rv2121c in Mycobacterium tuberculosis H37Rv

Annotation: ATP phosphoribosyltransferase HisG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00070: ATP phosphoribosyltransferase" amino acids 2 to 182 (181 residues), 174.7 bits, see alignment E=1.8e-55 PF01634: HisG" amino acids 49 to 204 (156 residues), 142.9 bits, see alignment E=8.4e-46 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 191 to 283 (93 residues), 94.3 bits, see alignment E=4.2e-31 PF08029: HisG_C" amino acids 210 to 280 (71 residues), 89 bits, see alignment E=1.8e-29

Best Hits

Swiss-Prot: 100% identical to HIS1_MYCBO: ATP phosphoribosyltransferase (hisG) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to mra:MRA_2136)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>Rv2121c ATP phosphoribosyltransferase HisG (Mycobacterium tuberculosis H37Rv)
MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF