Protein Info for Rv2118c in Mycobacterium tuberculosis H37Rv

Annotation: RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 191 to 209 (19 residues), see Phobius details PF14801: GCD14_N" amino acids 4 to 54 (51 residues), 88.7 bits, see alignment 5.5e-29 PF01135: PCMT" amino acids 73 to 204 (132 residues), 29.4 bits, see alignment E=2.1e-10 PF08704: GCD14" amino acids 73 to 237 (165 residues), 71 bits, see alignment E=3.8e-23 PF13847: Methyltransf_31" amino acids 99 to 221 (123 residues), 27.7 bits, see alignment E=6.3e-10 PF13649: Methyltransf_25" amino acids 103 to 197 (95 residues), 32.8 bits, see alignment E=2.8e-11 PF08241: Methyltransf_11" amino acids 104 to 200 (97 residues), 22.7 bits, see alignment E=3.9e-08

Best Hits

Swiss-Prot: 100% identical to TRMI_MYCTU: tRNA (adenine(58)-N(1))-methyltransferase TrmI (trmI) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07442, tRNA (adenine-N1-)-methyltransferase catalytic subunit [EC: 2.1.1.36] (inferred from 100% identity to mbb:BCG_2135c)

Predicted SEED Role

"Protein-L-isoaspartate methyltransferase (EC 2.1.1.77)" (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.36 or 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>Rv2118c RNA methyltransferase (Mycobacterium tuberculosis H37Rv)
VSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGA
LFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRA
VGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDML
APWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGL
AVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG