Protein Info for Rv2112c in Mycobacterium tuberculosis H37Rv

Annotation: Deamidase of pup Dop

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03688: proteasome accessory factor PafA2" amino acids 51 to 538 (488 residues), 804.9 bits, see alignment E=1.3e-246 PF03136: Pup_ligase" amino acids 52 to 507 (456 residues), 615 bits, see alignment E=4.5e-189

Best Hits

Swiss-Prot: 100% identical to DOP_MYCTO: Pup deamidase/depupylase (dop) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv2112c)

MetaCyc: 100% identical to Pup deamidase/depupylase (Mycobacterium tuberculosis H37Rv)
RXN-16706 [EC: 3.5.1.119]; 3.4.99.M1 [EC: 3.5.1.119, 3.4.99.M1]

Predicted SEED Role

"Pup ligase PafA' paralog, possible component of postulated heterodimer PafA-PafA'" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Proteasome archaeal

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.99.M1 or 3.5.1.119

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>Rv2112c Deamidase of pup Dop (Mycobacterium tuberculosis H37Rv)
MFWVGGPCLMPASSAARCAARIVGGRCLMPASSAARCAARIVGGPRLYGMQRIIGTEVEY
GISSPSDPTANPILTSTQAVLAYAAAAGIQRAKRTRWDYEVESPLRDARGFDLSRSAGPP
PVVDADEVGAANMILTNGARLYVDHAHPEYSAPECTDPLDAVIWDKAGERVMEAAARHVA
SVPGAAKLQLYKNNVDGKGASYGSHENYLMSRQTPFSAIITGLTPFLVSRQVVTGSGRVG
IGPSGDEPGFQLSQRSDYIEVEVGLETTLKRGIINTRDEPHADADRYRRLHVIIGDANLA
ETSTYLKLGTTALVLDLIEEGPAHAIDLTDLALARPVHAVHAISRDPSLRATVALADGRE
LTGLALQRIYLDRVAKLVDSRDPDPRAADIVETWAHVLDQLERDPMDCAELLDWPAKLRL
LDGFRQRENLSWSAPRLHLVDLQYSDVRLDKGLYNRLVARGSMKRLVTEHQVLSAVENPP
TDTRAYFRGECLRRFGADIAAASWDSVIFDLGGDSLVRIPTLEPLRGSKAHVGALLDSVD
SAVELVEQLTAEPR