Protein Info for Rv2109c in Mycobacterium tuberculosis H37Rv

Annotation: Proteasome alpha subunit PrcA; assembles with beta subunit PrcB.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details TIGR03691: proteasome, alpha subunit" amino acids 2 to 234 (233 residues), 385.3 bits, see alignment E=4.3e-120 PF00227: Proteasome" amino acids 26 to 204 (179 residues), 81.5 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 100% identical to PSA_MYCTF: Proteasome subunit alpha (prcA) from Mycobacterium tuberculosis (strain F11)

KEGG orthology group: K03432, proteasome alpha subunit [EC: 3.4.25.1] (inferred from 99% identity to mbb:BCG_2126c)

Predicted SEED Role

"Proteasome subunit alpha (EC 3.4.25.1), bacterial" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Proteasome archaeal (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>Rv2109c Proteasome alpha subunit PrcA; assembles with beta subunit PrcB. (Mycobacterium tuberculosis H37Rv)
VSFPYFISPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELYDRV
GFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTLGTIFTEQAKPYEV
ELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMGGTTEPIANALKESYAENASLTDA
LRIAVAALRAGSADTSGGDQPTLGVASLEVAVLDANRPRRAFRRITGSALQALLVDQESP
QSDGESSG