Protein Info for Rv2097c in Mycobacterium tuberculosis H37Rv

Annotation: Proteasome accessory factor a PafA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR03686: Pup--protein ligase" amino acids 3 to 452 (450 residues), 803.1 bits, see alignment E=3.4e-246 PF03136: Pup_ligase" amino acids 4 to 423 (420 residues), 570.4 bits, see alignment E=1.5e-175

Best Hits

Swiss-Prot: 100% identical to PAFA_MYCTU: Pup--protein ligase (pafA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K13571, proteasome accessory factor A [EC: 6.3.2.-] (inferred from 100% identity to mbt:JTY_2111)

MetaCyc: 100% identical to prokaryotic ubiquitin-like protein ligase (Mycobacterium tuberculosis H37Rv)
RXN-16707 [EC: 6.3.1.19]

Predicted SEED Role

"Pup ligase PafA, possible component of postulated heterodimer PafA-PafA'" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Proteasome archaeal

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.1.19 or 6.3.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>Rv2097c Proteasome accessory factor a PafA (Mycobacterium tuberculosis H37Rv)
VQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGS
HPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSY
GCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVS
SATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAF
RDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIE
QVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDI
KRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWV
HLKLNDQAQRTVLCKDPFRAVDERVKRLIASM