Protein Info for Rv2096c in Mycobacterium tuberculosis H37Rv

Annotation: Proteasome accessory factor B PafB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13280: WYL" amino acids 154 to 218 (65 residues), 69.4 bits, see alignment E=2.2e-23 PF25583: WCX" amino acids 253 to 326 (74 residues), 45.1 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 100% identical to PAFB_MYCTO: Protein PafB (pafB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K13572, proteasome accessory factor B (inferred from 100% identity to mbo:Mb2123c)

Predicted SEED Role

"FIG005453: Putative DeoR-family transcriptional regulator" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>Rv2096c Proteasome accessory factor B PafB (Mycobacterium tuberculosis H37Rv)
MATSKVERLVNLVIALLSTRGYITAEKIRSSVAGYSDSPSVEAFSRMFERDKNELRDLGI
PLEVGRVSALEPTEGYRINRDAYALSPVELTPDEAAAVAVATQLWESPELITATQGALLK
LRAAGVDVDPLDTGAPVAIASAAAVSGLRGSEDVLGILLSAIDSGQVVQFSHRSSRAEPY
TVRTVEPWGVVTEKGRWYLVGHDRDRDATRVFRLSRIGAQVTPIGPAGATTVPAGVDLRS
IVAQKVTEVPTGEQATVWVAEGRATALRRAGRSAGPRQLGGRDGEVIELEIRSSDRLARE
ITGYGADAIVLQPGSLRDDVLARLRAQAGALA