Protein Info for Rv2093c in Mycobacterium tuberculosis H37Rv

Annotation: Sec-independent protein translocase transmembrane protein TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 27 to 260 (234 residues), 261 bits, see alignment E=5.1e-82 PF00902: TatC" amino acids 29 to 252 (224 residues), 219.3 bits, see alignment E=2.6e-69

Best Hits

Swiss-Prot: 100% identical to TATC_MYCTO: Sec-independent protein translocase protein TatC (tatC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to mbt:JTY_2107)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv2093c Sec-independent protein translocase transmembrane protein TatC (Mycobacterium tuberculosis H37Rv)
VRAAGLLKRLNPRNRRSRVNPDATMSLVDHLTELRTRLLISLAAILVTTIFGFVWYSHSI
FGLDSLGEWLRHPYCALPQSARADISADGECRLLATAPFDQFMLRLKVGMAAGIVLACPV
WFYQLWAFITPGLYQRERRFAVAFVIPAAVLFVAGAVLAYLVLSKALGFLLTVGSDVQVT
ALSGDRYFGFLLNLLVVFGVSFEFPLLIVMLNLAGLLTYERLKSWRRGLIFAMFVFAAIF
TPGSDPFSMTALGAALTVLLELAIQIARVHDKRKAKREAAIPDDEASVIDPPSPVPAPSV
IGSHDDVT