Protein Info for Rv2073c in Mycobacterium tuberculosis H37Rv
Annotation: Probable shortchain dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y2073_MYCTU: Uncharacterized oxidoreductase Rv2073c (Rv2073c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to mtc:MT2133)MetaCyc: 42% identical to decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase (Mycolicibacterium smegmatis MC2 155)
RXN-11081 [EC: 1.1.1.333]
Predicted SEED Role
"Short-chain dehydrogenase/reductase SDR"
MetaCyc Pathways
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (33/33 steps found)
- mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (18/18 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.1.1.333
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (249 amino acids)
>Rv2073c Probable shortchain dehydrogenase (Mycobacterium tuberculosis H37Rv) VDDTGAAPVVIFGGRSQIGGELARRLAAGATMVLAARNADQLADQAAALRAAGAIAVHTR EFDADDLAAHGPLVASLVAEHGPIGTAVLAFGILGDQARAETDAAHAVAIVHTDYVAQVS LLTHLAAAMRTAGRGSLVVFSSVAGIRVRRANYVYGSAKAGLDGFASGLADALHGTGVRL LIARPGFVIGRMTEGMTPAPLSVTPERVAAATARALVNGKRVVWIPWALRPMFVALRLLP RFVWRRMPR