Protein Info for Rv2066 in Mycobacterium tuberculosis H37Rv

Annotation: Probable bifunctional protein, CobI-COBJ fusion protein: S-adenosyl-L-methionine-precorrin-2 methyl transferase + precorrin-3 methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 TIGR01467: precorrin-2 C(20)-methyltransferase" amino acids 5 to 236 (232 residues), 205.5 bits, see alignment E=7.5e-65 PF00590: TP_methylase" amino acids 6 to 219 (214 residues), 144.7 bits, see alignment E=2e-46 amino acids 248 to 457 (210 residues), 107.5 bits, see alignment E=4.8e-35 TIGR01466: precorrin-3B C17-methyltransferase" amino acids 249 to 492 (244 residues), 257 bits, see alignment E=1.7e-80

Best Hits

Swiss-Prot: 100% identical to COBIJ_MYCTU: Cobalamin biosynthesis protein CobIJ (cobIJ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K13540, precorrin-2 C20-methyltransferase / precorrin-3B C17-methyltransferase [EC: 2.1.1.130 2.1.1.131] (inferred from 100% identity to mtb:TBMG_01915)

Predicted SEED Role

"Cobalt-precorrin-2 C20-methyltransferase (EC 2.1.1.130) / Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.130 or 2.1.1.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>Rv2066 Probable bifunctional protein, CobI-COBJ fusion protein: S-adenosyl-L-methionine-precorrin-2 methyl transferase + precorrin-3 methylase (Mycobacterium tuberculosis H37Rv)
MSARGTLWGVGLGPGDPELVTVKAARVIGEADVVAYHSAPHGHSIARGIAEPYLRPGQLE
EHLVYPVTTEATNHPGGYAGALEDFYADATERIATHLDAGRNVALLAEGDPLFYSSYMHL
HTRLTRRFNAVIVPGVTSVSAASAAVATPLVAGDQVLSVLPGTLPVGELTRRLADADAAV
VVKLGRSYHNVREALSASGLLGDAFYVERASTAGQRVLPAADVDETSVPYFSLAMLPGGR
RRALLTGTVAVVGLGPGDSDWMTPQSRRELAAATDLIGYRGYLDRVEVRDGQRRHPSDNT
DEPARARLACSLADQGRAVAVVSSGDPGVFAMATAVLEEAEQWPGVRVRVIPAMTAAQAV
ASRVGAPLGHDYAVISLSDRLKPWDVIAARLTAAAAADLVLAIYNPASVTRTWQVGAMRE
LLLAHRDPGIPVVIGRNVSGPVSGPNEDVRVVKLADLNPAEIDMRCLLIVGSSQTRWYSV
DSQDRVFTPRRYPEAGRATATKSSRHSD