Protein Info for Rv2055c in Mycobacterium tuberculosis H37Rv

Annotation: 30S ribosomal protein S18 RpsR2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 TIGR00165: ribosomal protein bS18" amino acids 20 to 75 (56 residues), 72.1 bits, see alignment E=1.8e-24 PF01084: Ribosomal_S18" amino acids 24 to 73 (50 residues), 79.6 bits, see alignment E=7.5e-27

Best Hits

Swiss-Prot: 100% identical to RS182_MYCBP: 30S ribosomal protein S18 2 (rpsR2) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K02963, small subunit ribosomal protein S18 (inferred from 100% identity to mtu:Rv2055c)

Predicted SEED Role

"SSU ribosomal protein S18p @ SSU ribosomal protein S18p, zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (88 amino acids)

>Rv2055c 30S ribosomal protein S18 RpsR2 (Mycobacterium tuberculosis H37Rv)
MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQV
AQAIKNAREMALLPYPGQDRQRRAALCP