Protein Info for Rv2051c in Mycobacterium tuberculosis H37Rv

Annotation: Polyprenol-monophosphomannose synthase Ppm1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 509 to 527 (19 residues), see Phobius details PF20154: LNT_N" amino acids 31 to 182 (152 residues), 111.2 bits, see alignment E=8.9e-36 TIGR00546: apolipoprotein N-acyltransferase" amino acids 76 to 478 (403 residues), 352.8 bits, see alignment E=1.4e-109 PF00795: CN_hydrolase" amino acids 243 to 487 (245 residues), 56.2 bits, see alignment E=5.2e-19 PF00535: Glycos_transf_2" amino acids 614 to 779 (166 residues), 111.3 bits, see alignment E=7.3e-36

Best Hits

Swiss-Prot: 100% identical to PPMNT_MYCBP: Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase (lnt) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to mtf:TBFG_12088)

MetaCyc: 100% identical to polyprenyl-phosphate beta-D-mannosyltransferase (Mycobacterium tuberculosis H37Rv)
2.4.1.M22 [EC: 2.4.1.M22]

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) in lipid-linked oligosaccharide synthesis cluster / Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.3.1.-, EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.4.1.83

Use Curated BLAST to search for 2.3.1.- or 2.4.1.83 or 2.4.1.M22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (874 amino acids)

>Rv2051c Polyprenol-monophosphomannose synthase Ppm1 (Mycobacterium tuberculosis H37Rv)
VKLGAWVAAQLPTTRTAVRTRLTRLVVSIVAGLLLYASFPPRNCWWAAVVALALLAWVLT
HRATTPVGGLGYGLLFGLVFYVSLLPWIGELVGPGPWLALATTCALFPGIFGLFAVVVRL
LPGWPIWFAVGWAAQEWLKSILPFGGFPWGSVAFGQAEGPLLPLVQLGGVALLSTGVALV
GCGLTAIALEIEKWWRTGGQGDAPPAVVLPAACICLVLFAAIVVWPQVRHAGSGSGGEPT
VTVAVVQGNVPRLGLDFNAQRRAVLDNHVEETLRLAADVHAGLAQQPQFVIWPENSSDID
PFVNPDAGQRISAAAEAIGAPILIGTLMDVPGRPRENPEWTNTAIVWNPGTGPADRHDKA
IVQPFGEYLPMPWLFRHLSGYADRAGHFVPGNGTGVVRIAGVPVGVATCWEVIFDRAPRK
SILGGAQLLTVPSNNATFNKTMSEQQLAFAKVRAVEHDRYVVVAGTTGISAVIAPDGGEL
IRTDFFQPAYLDSQVRLKTRLTPATRWGPILQWILVGAAAAVVLVAMRQNGWFPRPRRSE
PKGENDDSDAPPGRSEASGPPALSESDDELIQPEQGGRHSSGFGRHRATSRSYMTTGQPA
PPAPGNRPSQRVLVIIPTFNERENLPVIHRRLTQACPAVHVLVVDDSSPDGTGQLADELA
QADPGRTHVMHRTAKNGLGAAYLAGFAWGLSREYSVLVEMDADGSHAPEQLQRLLDAVDA
GADLAIGSRYVAGGTVRNWPWRRLVLSKTANTYSRLALGIGIHDITAGYRAYRREALEAI
DLDGVDSKGYCFQIDLTWRTVSNGFVVTEVPITFTERELGVSKMSGSNIREALVKVARWG
IEGRLSRSDHARARPDIARPGAGGSRVSRADVTE