Protein Info for Rv2044c in Mycobacterium tuberculosis H37Rv
Annotation: Conserved hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to mtc:MT2104)Predicted SEED Role
"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)
MetaCyc Pathways
- NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
- NAD salvage pathway V (PNC V cycle) (4/5 steps found)
- superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
- aldoxime degradation (1/3 steps found)
- NAD salvage (plants) (5/11 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.19
Use Curated BLAST to search for 3.5.1.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (105 amino acids)
>Rv2044c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv) MHFAFIAYVLAGGFLALRWRRTMWLHVPAVIWGIGIAAKRVDCPLTWVERWARTKAAMTP LSPDGFVAHYITGVIYPAGWVAAAQLVMFAIVAASWTLYLWLPRR