Protein Info for Rv2040c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sugar-transport integral membrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 65 to 95 (31 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 290 (205 residues), 57.6 bits, see alignment E=7.2e-20

Best Hits

Swiss-Prot: 38% identical to YURN_BACSU: Probable ABC transporter permease protein YurN (yurN) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to mtf:TBFG_12077)

Predicted SEED Role

"Probable sugar-transport integral membrane protein ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv2040c Probable sugar-transport integral membrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MTRRRGRRAWAGRMFVAPNLAAVVVFMLFPLGFSLYMSFQKWDLFTHATFVRLDNFRNLF
TSDPLFLIAVVNTAVYTVGTVVPTVIVSLVVAAFLNRKIKGISLFRTVVFLPLAISSVVM
AVVWQFVFNTDNGLLNIMLGWLGIGPIPWLIEPRWAMVSLCLVSVWRSVPFATVVLLAAM
QGVPETVYEAARIDGAGEIRQFVSITVPLIRGALSFVVVISIIHAFQAFDLVYVLTGANG
GPETATYVLGIMLFQHAFSFLEFGYASALAWVMFAILLVLTVLQLRITHRRSWEASRGLG