Protein Info for Rv2030c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 PF00156: Pribosyltran" amino acids 24 to 179 (156 residues), 52.3 bits, see alignment E=4.1e-18 PF05139: Erythro_esteras" amino acids 294 to 656 (363 residues), 413.1 bits, see alignment E=1.6e-127

Best Hits

Swiss-Prot: 100% identical to Y2030_MYCTO: Uncharacterized protein MT2089 (MT2089) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06880, (no description) K07100, (no description) (inferred from 100% identity to mra:MRA_2045)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (681 amino acids)

>Rv2030c Conserved protein (Mycobacterium tuberculosis H37Rv)
VLMTAAADVTRRSPRRVFRDRREAGRVLAELLAAYRDQPDVIVLGLARGGLPVAWEVAAA
LHAPLDAFVVRKLGAPGHDEFAVGALASGGRVVVNDDVVRGLRITPQQLRDIAEREGREL
LRRESAYRGERPPTDITGKTVIVVDDGLATGASMFAAVQALRDAQPAQIVIAVPAAPEST
CREFAGLVDDVVCATMPTPFLAVGESFWDFRQVTDEEVRRLLATPTAGPSLRRPAASTAA
DVLRRVAIDAPGGVPTHEVLAELVGDARIVLIGESSHGTHEFYQARAAMTQWLIEEKGFG
AVAAEADWPDAYRVNRYVRGLGEDTNADEALSGFERFPAWMWRNTVVRDFVEWLRTRNQR
YESGALRQAGFYGLDLYSLHRSIQEVISYLDKVDPRAAARARARYACFDHACADDGQAYG
FAAAFGAGPSCEREAVEQLVDVQRNALAYARQDGLLAEDELFYAQQNAQTVRDAEVYYRA
MFSGRVTSWNLRDQHMAQTLGSLLTHLDRHLDAPPARIVVWAHNSHVGDARATEVWADGQ
LTLGQIVRERYGDESRSIGFSTYTGTVTAASEWGGIAQRKAVRPALHGSVEELFHQTADS
FLVSARLSRDAEAPLDVVRLGRAIGVVYLPATERQSHYLHVRPADQFDAMIHIDQTRALE
PLEVTSRWIAGENPETYPTGL