Protein Info for Rv1988 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 23S rRNA methyltransferase Erm(37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00398: RrnaAD" amino acids 20 to 172 (153 residues), 78.3 bits, see alignment E=8.1e-26 PF13649: Methyltransf_25" amino acids 36 to 98 (63 residues), 35 bits, see alignment E=2.8e-12 PF08241: Methyltransf_11" amino acids 38 to 96 (59 residues), 27.2 bits, see alignment E=7.4e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to mtf:TBFG_12019)

Predicted SEED Role

"rRNA adenine N-6-methyltransferase (EC 2.1.1.48)" (EC 2.1.1.48)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>Rv1988 Probable 23S rRNA methyltransferase Erm(37) (Mycobacterium tuberculosis H37Rv)
VSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAV
ELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLV
AADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR