Protein Info for Rv1983 in Mycobacterium tuberculosis H37Rv

Annotation: PE-PGRS family protein PE_PGRS35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF00934: PE" amino acids 4 to 93 (90 residues), 116.7 bits, see alignment E=6.8e-38 PF21526: PGRS" amino acids 122 to 191 (70 residues), 61.3 bits, see alignment E=1.3e-20 PF20729: PE-PGRS_C" amino acids 269 to 552 (284 residues), 341.8 bits, see alignment E=4.2e-106

Best Hits

Swiss-Prot: 100% identical to PG35_MYCTU: Uncharacterized PE-PGRS family protein PE_PGRS35 (PE_PGRS35) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02006)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>Rv1983 PE-PGRS family protein PE_PGRS35 (Mycobacterium tuberculosis H37Rv)
VSFLVVVPEFLTSAAADVENIGSTLRAANAAAAASTTALAAAGADEVSAAVAALFARFGQ
EYQAVSAQASAFHQQFVQTLNSASGSYAAAEATIASQLQTAQHDLLGAVNAPTETLLGRP
LIGDGAPGTATSPNGGAGGLLYGNGGNGYSATASGVGGGAGGSAGLIGNGGAGGAGGPNA
PGGAGGNGGWLLGNGGIGGPGGASSIPGMSGGAGGTGGAAGLLGWGANGGAGGLGDGVGV
DRGTGGAGGRGGLLYGGYGVSGPGGDGRTVPLEIIHVTEPTVHANVNGGPTSTILVDTGS
AGLVVSPEDVGGILGVLHMGLPTGLSISGYSGGLYYIFATYTTTVDFGNGIVTAPTAVNV
VLLSIPTSPFAISTYFSALLADPTTTPFEAYFGAVGVDGVLGVGPNAVGPGPSIPTMALP
GDLNQGVLIDAPAGELVFGPNPLPAPNVEVVGSPITTLYVKIDGGTPIPVPSIIDSGGVT
GTIPSYVIGSGTLPANTNIEVYTSPGGDRLYAFNTNDYRPTVISSGLMNTGFLPFRFQPV
YIDYSPSGIGTTVFDHPA