Protein Info for Rv1965 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical integral membrane protein YrbE3B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 47 to 75 (29 residues), see Phobius details amino acids 82 to 97 (16 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details PF02405: MlaE" amino acids 53 to 258 (206 residues), 181 bits, see alignment E=1.2e-57

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to mra:MRA_1976)

Predicted SEED Role

"Conserved hypothetical integral membrane protein YrbE1B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>Rv1965 Conserved hypothetical integral membrane protein YrbE3B (Mycobacterium tuberculosis H37Rv)
MTAAKALVSEWNRMGSQMRFFVGTLAGIPDALMHYRGELLRVIAQMGLGTGVLAVIGGTV
AIVGFLAMTTGAIVAVQGYNQFASVGVEALTGFASAFFNTREIQPGTVMVALAATVGAGT
TAALGAMRINEEIDALEVIGIRSISYLASTRVLAGVVVAVPLFCVGLMTAYLAARVGTTA
IYGQGSGVYDHYFNTFLRPTDVLWSSVEVVVVALMIMLVCTYYGYAAHGGPAGVGEAVGR
AVRASMVVASIAILVMTLAIYGQSPNFHLAT